Content of Volume 8 (2004) |
January |
|
February |
- DNA-cellulose chromatography
- Chemical modifications of proteins
|
March |
- Mitocondrial DNA (mtDNA) and crime investigation
- RNA interference
|
April |
- Codice di guerra per i militari in Iraq
- A new application of nanotechnology for the ARMY
|
May |
|
June |
- Biomimetics in the industrial arena
|
July |
- Biological Diversity and Environment
- On the path to synthetic biology: from high-affinity receptors to biocatalysis
|
September |
- Primary structure determination of peptides and proteins: enzymatic cleavage methods
|
October |
- Primary structure determination of peprides and proteins: chemical cleavage methods
|
November |
- Stress-regulating peptides in vertebrates
|
December |
- The characterization of a LH release-inhibiting factor (LH RIF), extracted from rat
- hypothalamus
- Nanotechnology - A new spin on sports
- Sauvagine and the neuroimmune endocrine system
- The technology transfer process
- Merry Christmas
|
January Some considerations on nanotechnology -
Although research in this field dates back to Richard P. Feynman's classic talk in 1959 ( http://www.zyvex.com/nanotech/feynman.html
) , the term nanotechnology was first coined by K. Eric Drexler in 1986 in the book Engines of Creation ( http://www.foresight.org/EOC/Engines.pdf )
As reported by the United States Government's National Nanotechnology Initiative, nanotechnology is defined as: "Research and technology
development at the atomic, molecular and macromolecular levels at the scale of approximately 1 - 100 nanometer range, to provide a fundamental
understanding of phenomena and materials at the nanoscale and to create and use structures, devices and systems that have novel properties and functions because of their small and / or intermediate size".
A simple definition of nanotechnology is the art of manipulating matter, atom by atom .
The name comes from the Greek word nanos, meaning dwarf and is usually combined with a noun to form words such as nanometer, nanobot and
nanotechnology. Nanotechnology refers to structures about one billionth of a meter in size (one thousandth the diameter of a human hair).
Nanostructures are prepared atom by atom to produce better materials with unique properties. "Biology is the nanotechnology that works"
- Tom Knight (MIT's Computer Science and Artificial Intelligence Laboratory)
BIOLOGICAL STRUCTURES |
DIMENSION [NANOMETERS (nm)] |
Protozoa |
20,000 - 200,000 |
Bacteria |
1,000 - 20,000 |
Virus |
75 - 100 |
Protein |
5 - 50 |
DNA (width) |
2 |
Atom |
0,1 |
Nanotechnology and Protein Folding protein-sized "nanomachines" |
"Dry" and "Wet" Nanotechnology |
Merrill Lynch has launched a nanotechnology stocks index.It is traded on the AMEX, under the symbol: NNZs Index components under the symbol NNZ of the American Stock Exchange |
Company Name |
Location |
URL |
Symbol |
% Weighting 04/19/04 |
% Weightin g 04/23/04 |
% Weighting 07/01/04 |
Acacia Research-CombimatrixSpecialty: Nano Biotech |
Mukilteo, WA. U.S.A. |
http://www.combimatrix.com |
CBMX |
4.07 |
4.18 |
4.79 |
Altair Nanotechnologies (Altair Nanomaterials)Speciality: Materials |
Reno, Nevada, U.S.A. |
www.altairinc.com |
ALTI |
5.17 |
4.80 |
3.68 |
Amcol IntlSpeciality: Materials |
Arlington Heights, IL, U.S.A. |
http://www.amcol.com |
ACO |
5.01 |
4.99 |
4.39 |
Biosante PharmaceuticalsSpeciality: Nano Biotech |
Lincolnshire, IL, U.S.A. |
http://www.biosantepharma.com |
BPA |
5.89 |
6.30 |
4.19 |
Cabot Corp.Speciality: Materials |
Boston, MA, U.S.A. |
http://www.cabot-corp.com |
CBT |
4.10 |
4.37 |
4.26 |
Fei Co. (Frequency Electronics Inc.)Speciality: Instrumentation |
Hillsboro, Oregon, U.S.A. |
http://www.freqelec.com |
FEIC |
4.54 |
4.55 |
3.87 |
Flamel TechnologiesSpeciality: Materials |
Venissieux Cedex France |
http://www.flamel-technologies.f r |
FLML |
4.95 |
5.11 |
3.85 |
Harris & Harris GroupSpeciality: Venture Capital |
New York, NY, U.S.A. |
http://www.hhgp.com |
TINY |
5.01 |
5.48 |
3.70 |
Headwaters Inc.Speciality: Semiconductors |
South Jordan, UT, U.S.A. |
http://hdwtrs.com |
HDWR |
4.95 |
4.47 |
4.21 |
Jmar technologiesSpeciality: Materials |
Carlsbad, CA, U.S.A. |
http://www.jmar.com |
JMAR |
5.25 |
4.83 |
4.01 |
Mts SystemsSpeciality: Instrumentation |
Eden Prairie, MN, U.S.A. |
http://www.mts.com |
MTSC |
4.38 |
4.18 |
4.11 |
Nanogen IncSpeciality: Nano Biotech |
San Diego, CA, U.S.A. |
http://www.nanogen.com |
NGEN |
4.20 |
4.37 |
4.30 |
Nanophase TechnologiesSpeciality: Materials |
Romeoville, IL, U.S.A. |
http://www.nanophase.com |
NANX |
4.19 |
4.23 |
4.58 |
Novavax Inc.Specialty: Nano Biotech |
Columbia, MD, U.S.A. |
http://www.novavax.com |
NVAX |
4.64 |
4.61 |
4.31 |
Nve Corp.Speciality: Intellectual Property |
Eden Prairie, MN, U.S.A |
http://www.nve.com |
NVEC |
3.71 |
3.80 |
5.17 |
Pharmacopeia Inc.Speciality: Nano Biotech |
Princeton, New Jersey, U.S.A. |
http://www.pharmacopeia.com |
ACCL |
3.67 |
3.82 |
4.34 |
Skyepharma Plc AdsSpeciality: Nano Biotech |
New York, New York, U.S.A. |
http://www.skypharma.com |
SKYE |
4.35 |
4.28 |
4.21 |
Symyx TechnologiesSpeciality: Materials |
Santa Clara, CA, U.S.A. |
http://www.symyx.com |
SMMX |
4.17 |
4.30 |
3.75 |
Tegal Corp.Specialty: Instrumentation |
Petalume, CA, U.S.A. |
http://www.tegal.com |
TGAL |
4.61 |
4.43 |
4.92 |
Ultratech Inc.Specialty: Semiconductors |
San Jose, CA, U.S.A. |
http://www.ultratech.com |
UTEK |
3.88 |
3.31 |
4.21 |
Veeco InstrumentsSpeciality: Instrumentation |
Woodbury, NY, U.S.A. |
http://www.veeco.com |
VECO |
4.50 |
4.55 |
4.03 |
Westaim CorpSpeciality: Venture Capital |
Calgary, Alberta, Canada |
http://www.westaim.com |
WEDX |
4,69 |
5,03 |
3.67 |
N.A. (Kopin Corp.)Specialty: Instrumentation |
Taunton, Massachusetts, U.S.A. |
http://www.kopin.com |
KOPN |
|
|
4.03 |
N.A (Immunicon Corp.).Specialty: Nano Biotech |
Huntingdon Valley, PA, U.S.A.. |
http://immunicon.com |
IMMC |
|
|
3.41 |
Index value |
|
|
|
|
|
234.48 |
Net Change |
|
|
|
|
|
3.82 (+) |
% Change |
|
|
|
|
|
1.66% (+) |
Source:"Making nanotechnology more than a nanoissue" by Barnaby J. Feder on The New York Times, April 17, 2004 http://www.hoovers.com/ Index components under the symbol NNZ of the American Stock Exchange http://www.amex.com http://www.amex.com/othProd/prodInf/OpPiIndComp.jsp?Product_Symbol=NNZ
"Nanotech Has a Multi Industry Impact" (published by Merrill Lynch on March 2004)
. |
SOLDIERS and NANOTECHNOLOGY
Institute for Soldier Nanotechnology (ISN, Cambridge, Massachusetts, U.S.A.) Interceptor Multi-Threat Body Armor System ( http://www.natick.army.mil )"The Objective Force Warrior Program"
"The Future Warrior program" |
References:"Soldiers and nanotechnology" by Stephan Herrera, Acumem 1, 52 - 58, 2003 |
Places to watch for nanotechnology referring to:
research, industry, venture capital, innovation, work force, costs: Top 10
- California
- Massachusetts
- New Mexico
- New York
- Texas
- Illinois
- Pennsylvania
- Michigan
- Connecticut
- Ohio
from: smalltimes 4 (2), 36 - 37 (2004)
Nanomaterials + tools for nanotechnology
nano-devices for life sciences |
Useful links and references:
Nanotechnology definition: National Nanotechnology Initiative ( http://www.nano.gov/omb_nifty50.htm
) Nanotechnology definition at
http://www.webopedia.com/TERM/N/nanotechnology.html
Nanotechnology created by dr. Ralph Merkle at http://www.zyvex.com/nano/
Nanotechnology glossary at: http://nanotech-now.com/nanotechnology-glossary.htm Nanomedicine book site at http://www.nanomedicine.com/ Fullerenes at http://buckminster.physics.sunysb.edu/ Nanotubes( or buckytubes ) at
http://www.webopedia.com/TERM/N/nanotube.html The nanotube site at
http://www.pa.msu.edu/cmp/csc/nanotube.html Quantum dot at
http://www.webopedia.com/TERM/Q/quantum_dot.html Dendrimer definition at
http://www.webopedia.com/TERM/D/dendrimer.html Veterinary applications of nanotechnology by Jose Feneque at http://nanotech-now.com/Veterinary-Applications-Nanotechnology.htm
Nanotechnology and friction at
http://www.plantservices.com/Web_First/PS.nsf/ArticleID/CBOH-5MRSF3?OpenDocument&Click= ( Harnessing nanotechnology for better
lubrication - Research shows nano-balls reduce friction better than plates - Dr. Menachem Genut )Design of a Primitive Nanofactory by Chris Phoenix at:
http://www.jetpress.org/volume13/Nanofactory.htm Journal of evolution and technology at: http://www.jetpress.org/ Nanotechnology and Life Extension by Chris Phoenix at http://xenophilia.org/nano_life_extension.html "Opportunities at the intersection of nanoscience, biology and computation" by Ellen Williams et al (November 2002)
Nanotechnology and global security - Adm. David E. Jeremiah, USN at:
http://www.zyvex.com/nanotech/nano4/jeremiahPaper.html Relinquishment or Regulation: dealing with apocalyptic technological threats by J. HughesIntracellular telephone wires - "
Nanotubular Highways for Intercellular Organelle Transport" by Amin Rustom, Rainer Saffrich, Ivanka Markovic, Paul Walther, and Hans-Hermann Gerdes, Science 303 (5660) 1007-1010 (2004)
Crucial physical and informational technologies http://www.e-drexler.com Hyperdictionary at http://www.hyperdictionary.com/ see also the links reported at The Trade Resource Center
(section Biotechnology)Nanoparticles for multiplexed bioassays at http://www.nanoplextech.com
(at Nanoplex Technologies, Inc. , Menlo Park, CA, U.S.A.)Market research on public attitudes to nanotecnology (BMRB's results and analysis) ( Nanotechnology study website http://www.nanotec.org.uk/MR1.htm )"
Construction of a viral nanomotor derived by a synthetic RNA " by Peixuan Guo at Purdue University (West Lafayette, Indiana, U.S.A.) (
http://www.vet.purdue.edu/PeixuanGuo/
) [ "Construction of viral DNA-Packaging Nano-motor of phi29 " by Peixuan Guo et al. - 10th Forensic Conference on Molecular Nanotechnology (October 11 - 13, 2002)]
RNA and nanomachines"RNA could form building blocks for nanomachines" at: http://news.uns.purdue.edu/UNS/html4ever/2004/040811.Guo.scaffold.html
" Microscopic scaffolding to house the tiny components of nanotech devices could be built from RNA, the same substance that shuttles messages around a cell's nucleus, reports a Purdue
University research group. " |
The energy currency for the cell
"Reactions in the body do not occur without energy currency"
Compounds such as ATP, GTP, NADP, etc, can serve as "energy currencies" that can store, transport and release amounts of energy that makes the extraordinary variety of biomolecules possible. References:"ATP: The Perfect Energy Currency for the Cell" by Jerry Bergman at
http://www.trueorigin.org/atp.asp
http://www.creationresearch.org/crsq/articles/36/36_1/atp.html
http://www.purlife.com/atpenergy.htm
"Energy for the Body:Oxidative Phosphorylation" by Rachel Casiday, Carolyn Herman, and Regina Frey at http://www.chemistry.wustl.edu/~edudev/LabTutorials/Cytochromes/cytochromes.html "Biology web site references for student and teachers- Cell Chemistry" at: http://hoflink.com/~house/cellchem.html
February
(ds)DNA-cellulose chromatography - DNA (double stranded) cellulose chromatography may provide a useful tool for separating proteins which
induce the maturation of the human myeloid precursor cells to granulocytes from other proliferative inducing proteins also present in the same conditioned medium. ( Figure 1 , Figure 2 ) Chemical modification of proteins
- Amino acid analysis with specific reference to problem amino acids
- Methionine, Methionine sulfone, Methionine sulfoxide, Tryptophan, Proline, 3-Hydroxyproline, 4-Hydroxyproline, Tyrosine sulphate, Homoserine, Homoserine lactone
- Preparation of peptides / proteins for hydrolysis
- Acid / Basic hydrolysis of proteins
- The use of D-amino acid oxidase, L-amino acid oxidase
- About hydrolysis for Trp detection (to assess the Tryptophan content in peptides / proteins :
- (i) samples for amino acid analyses were hydrolysed for 16 h at 110 C in 4 N methanesulphonic acid [containing 0.2%
3-(2aminoethyl)indole] [comparisonwith an identical sample submitted to hydrolysis with 6N HCl (constant boiling and containing 0.2% phenol)] - Detection with ninhydrin, OPA / FMOC derivatives,
- (ii) Spectrophotometric titration of the tryptophyl residues [ H. Edelhoch Biochemistry 6, 1948 - 1954, (1967)]
Complete enzymatic hydrolysis of proteins (with the use of soluble and insoluble enzymes; treatment with aminopeptidase M and
carboxypeptidases to demonstrate that all the amino acid residues were in the L-form within the structure)
Peptidic material visualized with
- Ninhydrin reagent (0,1% ninhydrin in 95% ethanol containing 2% sym-collidine)
- Cl 2 (followed by spraying with 0.5% starch in 0.5% KI) [H.N. Rydon & P.W.G. Smith Nature 169, 922 - 923 (1952)]
- Specific color-reactions for amino acids
- p-dimethylaminobenzaldehyde (Ehrlich's reagent) for tryptophan
- Pauli 's reagent for histidine
- isatin reagent for proline [J. Smith Nature 171, 43 - 44 (1953)]
- isatin reagent followed by the Ehrlich's reagent for 4-hydroxyproline [ C.E. Dangliesh Biochem J. 52, 3 - 14 (1952); J.B. Jepson & I. Smith Nature 172
, 1100 - 1101 (1953); T. Nakajima & B.E. Volcani Science 164 , 1400 - 1401 (1969)]; characterization of 3-hydroxyproline from 4-hydroxyproline
- Sakaguchi's reagent for arginine [J.B. Jepson & I. Smith Nature 172, 1100- 1101 (1953)]
-
a-nitroso-
b-naphtol reagent for tyrosine [ C.W. Easley
Biochim. Biophys. Acta 107, 386 - 388 (1965)]
platinic-iodide reagent for methionine[ G. Toennies & J.J. Kolb Anal. Chem. 23, 823 - 826 (1951)]
Fluorescamine (0,0002% fluorescamine in acetone) [J. Vanderkerckhove & M. Van Montagu European J. Biochem 44, 279 - 288 (1974)]
The o-phthalaldehyde (OPA) derivatives of the amino acids
The 9-fluorenylmethyloxycarbonyl chloride (FMOC) derivatives of the amino acids
Spectrophotometric titration of the tyrosyl residues [ T. Flatmark Acta Chem. Scand. 18, 1796 - 1798 (1964)]
Separation of amino acids on 2D HVPE (high voltage paper electrophoresis) / chromatography, thin layer chromatography, chromatography on polyamide sheets )
Analysis and calculation
End-group methods
- Sequential degradation and determination of amino-terminal residues [
manual Edman degradation , automatic Edman degratation, RP-HPLC systems for PTH-AA analysis ( "N-terminal sequence of some ribosome-inactivating proteins" by P.C. Montecucchi et al, Int. J. Peptide Protein Res
. 33, 263 - 267 (1989)]
Dansylation (dansyl, 5-dimethylaminonaphthalene-1-sulphonyl)
Removal of the N-terminal amino acid residues by the action of leucine amino-peptidase, amino-peptidase M
Anomalous degradation from the N-terminal end of peptides with amino-peptidase M: diketopiperazine formation (the removal of
the N-terminal amino acid residue is followed by the simultaneous elimination of the adjacent dipeptide by diketopiperazine formation
L-pyroglutamyl-peptide hydrolase ( the bond <Glu - Pro-... is resistant to the enzymatic treatment )
De-blocking peptides [ <Glu - Pro-...] using partial acid hydrolysis (0.01M HCl at 100 C for 6 hr); the peptide was then submitted to Edman degradation
The N-terminus <Glu - Pro-... : treatment with a proline specific endopeptidase (from Seikagaku Kogyo CO. Ltd., Japan), for
example in the structure elucidation of eledoisin <Glu-Pro-Ser-Lys-Asp-Ala-Phe-Ile-Gly-Leu-Met-NH2
Determination of COOH-terminal sequences
- by enzymatic methods (carboxypeptidase A, B and Y )
- by chemical methods [hydrazinolysis, partial acid hydrolysis (with 0.03N HCl at 100 C for 6h), hydrazynolysis after partial acid hydrolysis]
- by isolation of the C-terminal amide fragments (Met-NH2 , Val-NH2), their conversion into the fluorescent dansyl
derivatives and subsequent identification by thin - layer chromatography on polyamide sheets , after extraction with ethyl acetate / water mixtures as described by Tatemoto and Mutt on
Proc. Natl. Acad. Sci. U.S.A. 75, 4115 - 4119 (1978);
- by field desorption mass spectrophotometric analysis (Molecular and quasi-molecular ion peaks were always obtained, often accompanied by the MNa + peak) ;
- by electrophoretic migration (HVPE. High voltage Paper Electrophoresis, isoelectric focusing technique)
Electrophoretic buffers for HVPE |
pH 1.2 |
99% formic acid / glacial acertic acid / water (170:100:730 by vol.) (1500V / 90 min; 35V x cm -1 , 100-110 mA) |
pH 1.9 |
|
pH 6.5 |
pyridine / glacial acetic acid / water (50:2:948 by vol.) (1500V / 45 min; 35V x cm -1 , 50 mA) |
The electrophoretic mobility was calculated in relation to tyrosine for VHPE at pH 1.2 or histidine / leucine/ glutamic acid for HVPE at pH 6.5 |
Reference: S. Guttmann & R.A. Boissonnas Helv. Chim. Acta 41, 1852 - 1882 (1958) |
Chromatography eluent for peptide separation on paper and silica gel thin-layer |
n-butanol / pyridine/ acetic acid / water (4:1:1:1 by vol.)n-butanol / glacial acetic acid / water (4:1:1 by vol.)
The chromatographic mobility was calculated in relation to specific amino acids |
- Chemical cleavage of peptides and proteins
- Cyanogen bromide cleavage (cleavage of the bond ...-Trp-Pro-...by CNBr in formic acid)
- Tyrosine - directed cleavage (with N-bromosuccinimide)
- Tyrosine nitration with tetranitromethane (TNM) [to identify Tyr and Ty(SO3H) residues in protein sequences]
- Arginine - directed trypsin cleavage (with citraconic anhydride)
- Partial acid hydrolysis
- Chemical modifications of proteins
- Tyrosine nitration with tetranitromethane (TNM) [to identify Tyr and Ty(SO3H) residues in protein sequences]
- The influence of thiol blocking on the resolution of basic proteins by two-dimensional electrophoresis
- Diastereoisomers separation
- thin layer chromatography
- column of the amino acid analyzer (for diastereoisomeric dipeptides)
- Fingerprint technique: The high voltage paper electrophoresis (HVPE) was run at pH 1.2 in the first direction at 1500 V for 90 min. The
electrophoretically separated zones were further purified by ascending chromatography in the second direction using the solvent system
n-butanol / pyridine / glacial acetic acid / water (4:1:1:1 by vol.). The spots were visualized for elution generally by staining with 0.0002% fluorescamine in acetone. The elution of the spots was made with 50% ethanol.
March
Mitocondrial DNA (mtDNA) and crime investigation - http://www.dpo.uab.edu/~jwells/mtDNA.htm
"Control region" (or "D-Loop": a non coding sequence (about 1100 bp) with the ipervariable segments HV1 and HV2.References: The role of DNA analysis on crime investigation Forensic mitocondrial DNA analysis
 RNA interference
Nature Reviews Genetics is pleased to present an animation on RNA interference - a result of a unique collaboration with Arkitek Studios, visual
specialists for science and technology. RNA interference (RNAi) is a form of post-transcriptional gene silencing in which short double-stranded RNAs induce degradation of
the homologous endogenous transcripts, mimicking the effect of the reduction, or loss, of gene activity. A series of three stunning movies show
you the steps that lead to siRNA-mediated transcript degradation, siRNA generation and amplification. - For free access to the Animation on RNA interference, visit http://info.nature.com/cgi-bin24/DM/y/eNqr0BgKQk0Cy0HoY0AO
Firms for Clinical Trials |
Alnylam Pharmaceuticals (Cambridge, Massachusetts, U.S.A.) , a leader in RNAi therapeutics- (
http://www.alnylam.com ) - Merger with Ribopharma (Kulmbach, Germany) - To test an RNAi technology in AIDS patients with macular degeneration condition. Benitec (St.
Lucia, Queensland, Australia) - Leader in Gene Silencing Technology - ( http://www.benitec.com.au ) - The firm
has acquired the company Avocel - Benitec plans to fund a clinical trial on children infected with HIV. This could be the first RNAi clinical trial to be submitted to the U.S. FDA. |
Reference: "RNA therapy beckons as firms prepare for clinical trials" on Nature 429, 792 (2004) |
References:Concocting a Knock-Out Punch for HIV-1
(Investigators probe RNA interference as a possible therapeutic strategy against HIV-1 infection by Aileen Constans on The Scientist 18 (6), 28 - 29 (2004) RNAi inches toward the clinic
by Amy Adams on The Scientist 18 (6), 32 - 35 (2004) RNAi applications in mammalian cells by Lisa Scherer and john J. Rossi on BioTechniques 36 (4), 557 -561 (2004)  April
Codice di guerra per i militari in Iraq by Pier Carlo Montecucchi on Analisi difesa 5 (44) 2004 - Lettera http://www.analisidifesa.it/numero44/lett-lettere.htm
A new application of nanotechnology for the ARMY - Army Scientists develop Liquid Body Armor By Tonya Johnson Army News Service April 21, 2004 - ABERDEEN PROVING GROUND, Md. - http://www.military.com/NewsContent/0,13319,usa3_042104.00.html
Liquid armor for Kevlar vests is one of the newest technologies being developed at the U.S. Army Research Laboratory to save Soldiers' lives.
This type of body armor is light and flexible, which allows soldiers to be more mobile and won't hinder an individual from running or aiming his or her weapon.
The key component of liquid armor is a shear thickening fluid. STF is composed of hard particles suspended in a liquid. The liquid, polyethylene
glycol, is non-toxic, and can withstand a wide range of temperatures. Hard, nano-particles of silica are the other components of STF. This combination of flowable and hard components results in a material with unusual properties. "During normal handling, the STF is very deformable and flows like a liquid. However, once a bullet or frag hits the vest, it transitions to a rigid
material, which prevents the projectile from penetrating the Soldier's body," said Dr. Eric Wetzel, a mechanical engineer from the Weapons and Materials Research Directorate who heads the project team.
To make liquid armor, STF is soaked into all layers of the Kevlar vest. The Kevlar fabric holds the STF in place, and also helps to stop the bullet. The saturated fabric can be soaked, draped, and sewn just like any other fabric. Wetzel and his team have been working on this technology with Dr. Norman J. Wagner and his students from the University of Delaware for three years.
"The goal of the technology is to create a new material that is low cost and lightweight which offers equivalent or superior ballistic properties as
compared to current Kevlar fabric, but has more flexibility and less thickness," said Wetzel. "This technology has a lot of potential."
Liquid armor is still undergoing laboratory tests, but Wetzel is enthusiastic about other applications that the technology might be applied to.
"The sky's the limit," said Wetzel. "We would first like to put this material in a soldier's sleeves and pants, areas that aren't protected by ballistic
vests but need to remain flexible. We could also use this material for bomb blankets, to cover suspicious packages or unexploded ordnance. Liquid
armor could even be applied to jump boots, so that they would stiffen during impact to support Soldiers' ankles."
In addition to saving Soldiers' lives, Wetzel said liquid armor in Kevlar vests could help those who work in law enforcement.
"Prison guards and police officers could also benefit from this technology," said Wetzel. "Liquid armor is much more stab resistant than
conventional body armor. This capability is especially important for prison guards, who are most often attacked with handmade sharp weapons."
For their work on liquid armor, Wetzel and his team were awarded the 2002 Paul A. Siple Award, the Army's highest award for scientific achievement, at the Army Science Conference.  May
Protein synthesis
- Non-ribosomal peptide synthesis
- Non ribosomal protein synthesis
- Ribosomal peptide synthesis
- Ribosomal protein synthesis
Normally, in bacteria and all other types of living cells, proteins are assembled according to DNA codes written in genes. Tiny cellular machines
called ribosomes determine a given protein's amino acid sequence by reading a template derived from the gene that codes for the protein.
But in 1965, scientists discovered an exception to this rule: peptide antibiotics — short, complex proteins secreted by bacteria and fungi to kill
rival cells — are manufactured solely by enzymes; their amino acid sequences are not spelled out by a genetic code.These peptide antibiotics were
synthesized using a multienzymatic template with a mechanism similar to that reported by Lynen for fatty acid biosynthesis. In accordance to
Lipman, this mechanism could be "a survival relic of a primitive mechanism of protein synthesis used early in evolution" [Montecucchi, P.C. et al. Int. J. Peptide Protein Res. 17
, 275 - 283 (1981); Montecucchi, P.C. et al. Int. J. Peptide Protein Res. 17, 316 - 321 (1981)]
Now, for the first time, Rockefeller University professor Vincent Fischetti and his colleagues Sung Lee and Vijaykumar Pancholi have discovered
an essential group A streptococcal enzyme also lacking a corresponding gene. This enzyme, called LPXTGase, attaches surface proteins to a bacterium's cell wall [ J. Biol, Chem. 277
(49) , 46912 - 46922 (2002)]. Swiss Protein Knowledgebase: http://www.expasy.ch/sprot
June
Biomimetics in the industrial arena - Biomimetics is the study of the structure and function of biological materials for the purpose of analogous synthetic design and manufacturing.
The benefit of mimicking nature's designs
Biological solutionsInspiration |
What? |
New potential industrial product |
Where |
Gecko tape |
To walk up a wall |
A new adhesive |
University of Manchester's Centre for Mesoscience and Nanotechnology |
Mmollusc abalon |
To build its shell |
Nanowire |
Angela Belcher at the Massachusetts Institute of Technology |
Euplectella, a deep-sea sponge |
Optical fiber |
Telecommunications networks |
Cherry Murray at Lucent Technologies' Bell Labs |
Butterfly wings |
Light to bend and reflect, creating shimmering color without pigment |
Tiny screens for mobile devices |
Iridigm Display Corp. , S. Francisco, CA, U.S.A.) ( htp://www.iridigm.com ) |
Insect aerodynamics |
|
Robotic fly |
Michael Dickinson at the California Institute of Technology |
References:"Researchers release betas of biomimetics after a few billion years in development" by David Pescovitz in smalltimes
4 (2), 64 (2004) The Biomimetics Network for Industrial Sustainability (BIONIS) at
http://www.extra.rdg.ac.uk/eng/BIONIS/current_issues.htm "Biomimetics and the Bug Man" by David Pescovitz on Popular Science (May 2004) ( http://www.popsci.com )"Fibre-optical features of a glass sponge" by Vikram C. Sundar et al on Nature
424 (6951), 899 (2003) "Biomimetic ratcheting motion of a soft, slender, sessile gel" by L. Mahadevan et al. PNAS , E-pub ahead of print dec 17, 2003, 10.1073/pnas.2637051100 (2003)
"Next Generation Biofactories" by Harvey Black on The Scientist 17 (15), 26 - 27 (2003) "Biomimetics: Materials fabrication through biology" by Mehmet Sarikaya on PNAS 96
(25), 14183 - 14185 (1999)
July
Biological Diversity and Environment
The study of biological diversity may become the method of choice to monitor the environment. The approch is the genomic sequencing of selected species of animals and plants (including microorganisms)
On the path to synthetic biology: from high-affinity receptors to biocatalysis
Artificial proteins with tailored catalytic activities, by the use of computer-based rational protein design, combined with directed evolution (random mutagenesis with in vivo
selection). It is possible to predict mutations that can introduce a desired biocatalytic activity into a protein that
normally lacks enzyme activity. Dwyer et al. have introduced triose phosphate isomerase (TIM) activity into the bacterial ribose-binding protein
(RBP), a periplasmatic receptor that has no known catalytic activity. In addition, the ability by Kuhlman et al "to design a new protein fold
makes possible the exploration of the large regions of the protein universe not yet explored in nature." (The design of a 93-residue alpha / beta
protein called Top7 with a novel sequence and topology). As reported by Sterner and Schmid, these results would be "amilestone on the path to
synthetic biology, with enormous potential for applications in medicine and biotechnology". Bioengineers try to create microbes from off-the-shelf parts.
Craig Venter plans to create microbes for pollution control. [a microbe with a syntheic genome [genomic skeleton (regulatory & functional genes)
to be used for solving environmental problems, geochemical processes under microbial control]
Nevertheless, the synthetic biology design could lead to the accidental or deliberate creation of pathogenic biological components, as reported by dr. George M. Church (Genetics, Harvard Medical School, MA, U.S.A.).
"reconverting, reengineering, reindustrialisation"of a living cell
The Synthetic Biology Building with BioBricksThe danger: The ability of biological processes to easily support self - replication |
A living and pre-existing cellAnalysis of cellular systems |
1 |
Components & Performance |
Collection and catalog of the biological parts [(BioBricks) functional characteristics: compatible, composible,
interchangeable, independent, reusable] |
General BioBricks' catalog |
Tools for system development and programming |
Methods for the production of the cellular componentse, analogues, their assembly methods |
2 |
Components & Performance |
Collection and catalog of the biological parts [(BioBricks) functional characteristics: compatible, composible,
interchangeable, independent, reusable] |
n |
Components & Performance |
Collection and catalog of the biological parts [(BioBricks) functional characteristics: compatible, composible,
interchangeable, independent, reusable] |
A synthetic "programmed" cell, through a re-engineering reconverting, reindustrialisation processThe creation of a minimal organism reengineering Mesoplasma florum (Mesoplasma florum is a Mycoplasma species with a genome size of 860 Kbp. This
organism was chosen because it is non-pathogenic, convenient to grow, and it has a relatively small genome. |
Synthetic biology for:
- microbial factories.
- cancer smart-bombs
- pollutant detectors.
- living calculators
|
References:"Computational design of a biologically active enzyme" by Mary A. Dwyer, Loren L. Looger, Homme W. Hellinga on Science 304
, 1967 - 1971 (2004) "De Novo design of an enzyme" by Reinhard Sterner and Franz X. Schmid on Science 304, 1916 - 1917 (2004) - The authors have "predicted
mutations that introduce triose phosphate isomerase activity into ribose-binding protein, a receptor that normally lacks enzyme activity". "Experts worry that synthetic biology may spawn biohackers" by Chappell Brown,
EE Times (June 29, 2004) http://www.eet.com/at/news/showArticle.jhtml?articleID=22102744
"Microbes made to order" by Dan Ferber on Science 303, 158 - 161 (2004)"Synthetic Life: Overview / Synthetic Biology" by W. Wayt Gibbs on Scientifc American, April 26, 2004
"Cells by design - The potential for synthetic biology" by Pamela Silver and Jeffrey Way on The Scientist, 18 (18), 30 - 31 (2004) About BioBricks:
- "BioBricks ho help reverse-engineer life" by Chappell Brown, EETimes (Advanced Technology, An EE Times Community), June 11, 2004 at
http://www.eetimes.com
MIT Registry of Standard Biological Parts (This site provides access to the MIT BioBricks Database) at http://parts.mit.edu
BioBricks Glossary at http://rosalind.csail.mit.edu
BioBricks alpha Logic Guide at http://rosalind.csail.mit.edu
Mesoplasma florum project information:
http://www.broad.mit.edu/annotation/microbes/mesoplasma_florum/background.html ;
http://www.syntheticbiology.org/projects.html :
http://www.broad.mit.edu/annotation/microbes/mesaplasma_florum/ "Design of a novel globular protein fold with atomic-level accuracy" by Brian Kuhlman et al. on Science 302
(5649), 1364 - 1368 (2003)"Tinker, tailor: can Venter stitch together a Genome from Scratch?" by Carl Zimmer on Science 299 (5609), 1006 - 1007 (2003)
"Microbial geoengineers" by Lesley A. Warren and Mary E. Kauffman on Science 299 (5609), 1027 - 1029 (2003) "Biosensor design" by William F. DeGrado on Nature 423
(6936) , 132 - 133 (2003) "Computational design of receptor and sensor proteins with novel functions" by Loren L. Looger, Mary A. Dwyer, James J. Smith & Homme W. Hellinga on Nature 423
(6936) , 185 - 190 (2003) (The systematic manipulation of binding sites, using a structure-based computational method;
the construction of soluble receptors that bind trinitrotoluene, L-Lactate or serotonine with high selectivity and affinity). Biological Simplicity and Complexity: The LEGO connector protocol at http://www.cds.caltech.edu/~doyle/CmplxNets/LegoPics.pdf
Nanoscale magnetic resonance imaging (MRI) by directly detecting the faint magnetic signal from a single electron buried inside a solid sample
(magnetic resonance force microscopy, MRFM) by Daniel Rugar, John Mamim, Raffi Budakian and Benjamain Chui at IBM's Almaden Research Center in San Jose, CA, U.S.A. ( New York Times
, July 14, 2004). Applying MRFM to protein structures would be of particular interest to understand the folded atomic configuration.i September
Primary structure determination of peptides and proteins: enzymatic cleavage methods
Enzymatic degradation of peptides and proteins |
| |
Aminopeptidase M ( EC 3.4.11.2) (AP-M); aminopeptidase M and the diketopiperazine formation:
Phe-Pro-Pro-Trp under the action of AP-M gives origin to Phe and Trp with the diketopiperazine (Pro-Pro) Glu-Lys-Pro-Tyr-..... under the action of AP-M gives origin to Glu, Tyr, and the diketopiperazine
(Lys-Pro).
L-pyroglutamyl peptide hydrolase (EC 3.4.11.8) |
| |
Cathepsin C (3.4.14.1) (the enzyme splits the peptide bond ...-Ala-Phe-...)Chymotrypsin (EC 3.4.21.1) Trypsin (EC 3.4.21.4) Pronase Arginine-directed
trypsin cleavage (it was obtained by first blocking the epsilon amino groups of the lysines with citraconic anhydride) Specific enzymatic cleavage of the peptide bond ...-Pro-Xxx-...
Splitting the bond ...-Glu-Lys-... by Staphylococcus aureus protease; the ckeavage ability is correlated to the position of the two amino acid residues in the amino acid chain
Subtilisin digestion: specific action at the Leu-Gly bond. |
| |
Enzymatic desulphatation |
| |
Carboxypeptidase A (EC 3.4.12.2)Carboxypeptidase Y (EC 3.4.12.-) |
| |
D-amino acid oxidase (EC 1.4.3.3.) |
October
Primary structure determination of peprides and proteins: chemical cleavage methods
Chemical degradation methodsChemical modification of peptides and proteins |
Amino acid analysis with specific reference to |
Methionine, Methionine sulfone, Methionine sulfoxide, Tryptophan, Proline, 3-Hydroxyproline, 4-Hydroxyproline, Tyrosine sulphate, Homoserine,
Homoserine lactone
- Preparation of peptides / proteins for hydrolysis
- Acid / Basic hydrolysis of proteins
- The use of D-amino acid oxidase, L-amino acid oxidase
- About hydrolysis for Trp detection (to assess the Tryptophan content in peptides / proteins :
- (i) samples for amino acid analyses were hydrolysed for 16 h at 110 C in 4 N methanesulphonic acid [containing 0.2% 3-(2aminoethyl)indole] [comparisonwith an identical sample submitted to hydrolysis with
6N HCl (constant boiling and containing 0.2% phenol)] - Detection with ninhydrin, OPA / FMOC derivatives,
- (ii) Spectrophotometric titration of the tryptophyl residues [ H. Edelhoch Biochemistry 6, 1948 - 1954, (1967)]
Complete enzymatic hydrolysis of proteins (with the use of soluble and insoluble enzymes; treatment with aminopeptidase M and carboxypeptidases to
demonstrate that all the amino acid residues were in the L-form within the structure)
Peptede / protein material visualized with
- Ninhydrin reagent (0,1% ninhydrin in 95% ethanol containing 2% sym-collidine)
- Cl 2 (followed by spraying with 0.5% starch in 0.5% KI) [H.N. Rydon & P.W.G. Smith Nature 169, 922 - 923 (1952)]
- Specific color-reactions for amino acids
- p-dimethylaminobenzaldehyde (Ehrlich's reagent) for tryptophan
- Pauli 's reagent for histidine
- isatin reagent for proline [J. Smith Nature 171, 43 - 44 (1953)]
- isatin reagent followed by the Ehrlich's reagent for 4-hydroxyproline [ C.E. Dangliesh Biochem J. 52, 3 - 14 (1952); J.B. Jepson & I. Smith Nature 172
, 1100 - 1101 (1953); T. Nakajima & B.E. Volcani Science 164 , 1400 - 1401 (1969)]; characterization of 3-hydroxyproline
from 4-hydroxyproline
Sakaguchi's reagent for arginine [J.B. Jepson & I. Smith Nature 172, 1100- 1101 (1953)]
a-nitroso-
b-naphtol reagent for tyrosine [ C.W. Easley
Biochim. Biophys. Acta 107, 386 - 388 (1965)]
platinic-iodide reagent for methionine[ G. Toennies & J.J. Kolb Anal. Chem. 23, 823 - 826 (1951)]
Fluorescamine (0,0002% fluorescamine in acetone) [J. Vanderkerckhove & M. Van Montagu European J. Biochem 44, 279 - 288 (1974)]
Silver stain (prtein maps on 2D polyacrylamide gels )
Coomassie Brilliant Blue (CBB) G-250 and R-250 [
Coomassie G (green)-250 is greenish, background is minimized); Coomassie R (red)-250 dye is reddish, high background]
The o-phthalaldehyde (OPA) derivatives of the amino acids
The 9-fluorenylmethyloxycarbonyl chloride (FMOC) derivatives of the amino acids
Spectrophotometric titration of the tyrosyl residues [ T. Flatmark Acta Chem. Scand. 18, 1796 - 1798 (1964)]
Separation of amino acids on 2D HVPE (high voltage paper electrophoresis) / chromatography, thin layer chromatography, chromatography on polyamide sheets )
Analysis and calculation (amino acid analysis & sequence analysis)
|
End-group methods |
Sequential degradation and determination of amino-terminal residues [ manual Edman degradation , automatic Edman degratation, RP-HPLC systems for PTH-AA analysis ( "N-terminal sequence of some
ribosome-inactivating proteins" by P.C. Montecucchi et al, Int. J. Peptide Protein Res. 33, 263 - 267 (1989)]
- Dansylation (dansyl, 5-dimethylaminonaphthalene-1-sulphonyl)
- Removal of the N-terminal amino acid residues by the action of leucine amino-peptidase, amino-peptidase M
- Anomalous degradation from the N-terminal end of peptides with amino-peptidase M: diketopiperazine formation (the removal of the N-terminal amino acid residue is followed by the simultaneous elimination of the
adjacent dipeptide by diketopiperazine formation
- L-pyroglutamyl-peptide hydrolase ( the bond <Glu - Pro-... is resistant to the enzymatic treatment )
- De-blocking peptides [ <Glu - Pro-...] using partial acid hydrolysis (0.01M HCl at 100 C for 6 hr); the peptide was then submitted to Edman degradation
- The N-terminus <Glu - Pro-... : treatment with a proline specific endopeptidase (from Seikagaku Kogyo CO. Ltd., Japan), for example in the structure elucidation of eledoisin
<Glu-Pro-Ser-Lys-Asp-Ala-Phe-Ile-Gly-Leu-Met-NH2
- Determination of COOH-terminal sequences
- by enzymatic methods (carboxypeptidase A, B and Y )
- by chemical methods [hydrazinolysis, partial acid hydrolysis (with 0.03N HCl at 100 C for 6h), hydrazynolysis after partial acid hydrolysis]
- by isolation of the C-terminal amide fragments (Met-NH2 , Val-NH2), their conversion into the fluorescent dansyl derivatives and subsequent identification by thin - layer
chromatography on polyamide sheets , after extraction with ethyl acetate / water mixtures as described by Tatemoto and Mutt on Proc. Natl. Acad. Sci. U.S.A. 75, 4115 - 4119 (1978);
- by field desorption mass spectrophotometric analysis (Molecular and quasi-molecular ion peaks were always obtained, often accompanied by the MNa + peak) ;
- by electrophoretic migration (HVPE. High voltage Paper Electrophoresis, isoelectric focusing technique)
|
Chemical cleavage of peptides and proteins |
- Cyanogen bromide cleavage (cleavage of the bond ...-Trp-Pro-...by CNBr in formic acid)
- Tyrosine - directed cleavage (with N-bromosuccinimide)
- Tyrosine nitration with tetranitromethane (TNM) [to identify Tyr and Ty(SO3H) residues in protein sequences]
- Arginine - directed trypsin cleavage (with citraconic anhydride)
- Partial acid hydrolysis (PAH) (0.01M HC at 100 C for 6 hr); examples: a) ..-Asp-... [..-Leu-Leu-Leu-Asp-Thr-NH2 giving origin , after PAH, to the three fragments: Leu-Leu-Leu , Asp, Thr-NH2
] ; b) ..-Pro-... [ <Glu-Pro-Trp-Val-... giving origin , after PAH, to the fragments: <Glu and Pro-Trp-Val-...]
|
Chemical modifications of proteins |
- Tyrosine nitration with tetranitromethane (TNM) [to identify Tyr and Ty(SO3H) residues in protein sequences]
- The influence of thiol blocking on the resolution of basic proteins by two-dimensional electrophoresis
|
November
Stress-regulating peptides in vertebrates
Definition of stress: mental or physical tension that results from physical, emotional, or chemical causes (from: http://www.hyperdictionary.com/dictionary/stress
Peptides with corticotropin-releasing activity and their role in the hypothalamic - pituitary - adrenal axis (HPA axis)
Primary structures of native peptides with corticotropin-releasing activity |
CRF (bovine) |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKL LD IA-NH2 |
CRF (ovine) |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKL LD IA-NH2 |
CRF (human, rat)) |
SEEPPISLDLTFHLLREVL EMARA
EQLAQQAHSNR KL ME I I
-NH2 |
Urotensin I (sucker) |
NDDPPISIDLTFHLLRNMI
EMAR I ENE REQAGLNR KY LD
EV-NH2 |
Urotensin I (carp) |
NDDPPISIDLTFHLLRNMI
EMARNENQREQA GLNR KY LD
EV-NH2 |
Sauvagine I (frog) |
ZGPPISIDL
SLE LLRKMI E I E
KQEKEKQQA ANNRLL LD
TI-NH2 |
Sauvagine II (frog)r |
ZGPPISIDL
SLE LLRKMI E I E
KEEKEK QQA ANNRLL LD
TI-NH2 |
Urocortin (Ucn) (human) |
DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
Urocortin (Ucn) (mouse, rat) |
DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
Urocortin II (Ucn II) (human) |
IVLSLDVPIGLLQILLEQARARAAREQATTNARILARV-NH2 |
Urocortin II (Ucn II) (mouse) |
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 |
Urocortin III (Ucn III) (human) [Stresscopin (3-40) (human)] |
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
Urocortin III (Ucn III) (mouse) |
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 |
Stresscopin (SCP) (human) |
TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
Stresscopin- Related Peptide (SRP) (Human) (representing a 5 amino acid-extended urocortin II at the amino terminus) |
HPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARV-NH2 |
The one-letter system of abbreviations for the amino acids has been used ("Nomenclature and Symbolism for Amino Acids and Peptides" on Int. J. Pept. Protein Res
. 24 (1984), 9. In particular, Z denotes pyrrolidonecarboxylic acid.Referring to CRF (corticotropin-releasing factor), sauvagines and urotensins I, the different amino acids in their sequences have been
reported in red . |
Structural similarities between sauvagine I (SAU) and ovine CRF. Identical amno acid residues are in green boxes ; amino acid residues as single base changes in
the respective mRNA codons are in blue boxes. |
Sauvagine 1 |
|
Z |
G |
P |
P |
I |
S |
I |
D |
L |
S |
L |
E |
L |
L |
R |
K |
M |
I |
E |
I |
E |
K |
Q |
E |
K |
E |
K |
Q |
Q |
A |
A |
N |
N |
R |
L |
L |
L |
D |
T |
I |
¥ |
Secondary structure prediction for SAU c=coli |
|
c |
b - turn |
c |
aa - helix |
b - turn |
b - sheet |
Ovine CRF |
S |
Q |
E |
P |
P |
I |
S |
L |
D |
L |
T |
F |
H |
L |
L |
R |
E |
V |
L |
E |
M |
T |
K |
A |
D |
Q |
L |
A |
Q |
Q |
A |
H |
S |
N |
R |
K |
L |
L |
D |
I |
A |
¥ |
Secondary structure prediction for CRF c = coil |
b - turn |
c |
b - sheet |
a - helix |
b - turn |
a - helix |
CRF receptors and ligands CRF ( CRF-R1 and CRF-R2) receptors belong to the class II superfamily of 'brain–gut' neuropeptide receptors, which all contain seven transmembrane helical domains and share
considerable sequence identity with one another. |
Receptors |
Ligands |
CRF-R1 (with multiple subtypes) |
Mammalian CRH-R1 receptors have an equal, yet high, affinity for human and ovine CRF, urocortin, sauvagine and urotensin
I (activation of the cyclic AMP signaling pathway) while not showing any affinity for urocortin II or III |
CRF-R2 (with multiple subtypes) |
Currently, urocortin 2 and urocortin 3 are generally considered to represent
the endogenous ligands for mammalian CRF2 receptor variants, whereas urocortin 1 is thought to be an endogenous ligand for both the CRF1 and CRF2
receptors. |
CRF -R3 from catfish |
CRF being a high-affinity ligand ( higher affinity than urotensin I and sauvagine) |
Corticotropin-releasing hormone receptors by E. W. Hillhouse1, H. Randeva, G. Ladds and D. Grammatopoulos Biochem. Soc. Trans. 30 (2001)
, 428–432International Union of Pharmacology. XXXVI. Current Status of the Nomenclature for Receptors for Corticotropin-Releasing Factor and Their Ligands by Richard L. Hauger, Dimitri E.
Grigoriadis, Mary F. Dallman, Paul M. Plotsky, Wylie W. Vale, and Frank M. Dautzenberg on Pharmacological Reviews 55 (2003) , Issue 1, 21-26 |
. December
The characterization of a LH release-inhibiting factor (LH RIF), extracted from rat hypothalamus
This work has been made by Pier Carlo Montecucchi in the laboratory of Prof. Marc Freeman at the Florida State University (Tallahassee, FL, U.S.A.)
A factor that suppresses GnRH-stimulated LH release from dispersed rat anterior pituitary cells was purified from rat hypothalami by gel
filtration on Sephadex G- 25, and G-100, DEAE Sephadex A-50 chromatography and RP-HPLC chromatography. The inhibitor appeared to be
very hydrophilic, with acid character and possessing a molecular weight in the range of 1000 - 2000 dalton. After treatment with proteolytic
enzymes (trypsin, chymotrypsin), the biological activity, as tested, disappeared; these observations seems to confirm the peptidic nature of the purified material.
Our results do not correspond to those previously reported in the same laboratory [ "Partial purification of a hypothalamic factor that inhibits
gonadotropin-releasing hormone-stimulated luteinizing hormone release" by Hwan JC, Freeman ME (1987) Endocrinology 120 (2):483-490; "A
physiological role for luteinizing hormone release-inhibiting factor of hypothalamic origin" by Hwan JC, Freeman ME (1987) Endocrinology 121
(3):1099-1103 ]. Should our data be confirmed, the luteinizing hormone release-inhibiting factor isolated would represent an additional example of natural "negative mini bio-regulators".
Negative / positive mini bio-regulators |
LiF |
Leucocyte immunosuppressive factor (MW 800 - 1000) |
LeF |
Leucocyte enhancer factor (MW 300 - 600) |
TIF |
Tumor inhibiting factor (MW 1000 - 1500) |
LH RIF |
Luteinizing hormone release-inhibiting factor (MW (1000 - 2000) |
Nanotechnology - A new spin on sportsDiscussion on the article written buy Kevin Maney (USA TODAY) at :
http://www.usatoday.com/tech/news/nano/2004-11-17-nanotechnology-sports_x.htm
Sport |
Company |
Golf |
AccuFLEX Golf, Inc. http://accuflexgolf.com/ (Gastonia, NC. U.S.A.)NanoDynamics www.nanodynamics.com (Buffalo, New York, U.S.A.)
Wilson Global Golf http://www.wilson.com/flash_intro/index.html |
Tennis |
InMat Inc. http://www.inmat.com/about.shtml (Hillsborough, NJ, U.S.A.)Wilson Glòobal Golf
http://www.wilson.com/flash_intro/index.html |
Biking |
Easton sports http://www.eastonsports.com/ (Van Nuys, CA, U.S.A.)
Zyvex http://www.zyvex.com/nano/
(Richardson, Texas, U.S.A. ) |
Bowling |
Nanodesu, a Japanese company http://www.nanodesu.com/ |
Nanotech is just emerging as an industrial force. In 2004, $13 billion worth of products will incorporate nanotechnology, less than 0.1 percent of
global output, according to the NanoBusiness Alliance trade group. By 2014, that figure is expected to rise to $2.6 trillion, or 15 percent of that year's manufacturing output
Sauvagine and the neuroimmune endocrine systemSauvagine (SAU) is a peptide of 40 amino acid residues. Two forms have been isolated and their primary structure is the following: Sauvagine I (SAU I):
pGlu-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Gln-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-As n-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2 Sauvagine II (SAU II) or [Glu
23 ] SAU IpGlu-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg-Lys-Met-Ile-Glu-Ile-Glu-Lys-Glu-Glu-Lys-Glu-Lys-Gln-Gln-Ala-Ala-Asn-A sn-Arg-Leu-Leu-Leu-Asp-Thr-Ile-NH2
In the present discussion, we are focusing our attention on the inhibitory effect of sauvagine on the prolactin release. The effect of sauvagine (SAU I) on prolactin (PRL)
levels was studied in vivo and in vitro. Subcutaneous administration of SAU (20 micrograms/kg) reduced plasma PRL levels in normal adult male rats and
suppressed the suckling-induced rise of PRL in lactating rats even at doses of 1 and 5 micrograms/kg. Perfusion of isolated and dispersed rat pituitary
cells in vitro with increasing doses of SAU (from 5 x 10(-10) to 1.7 x 10(-8)M) induced a significant dose-related decrease of PRL secretion in the eluate. These results indicate that SAU is a potent PRL
inhibiting factor and that its action is exerted at the pituitary level. If SAU or a SAU-related peptide is present in the mammalian brain, it can be
tentatively hypothesized that this peptide plays an important role in the control of PRL secretion. [ It is well known the effect of prolactin release on the immune system.
Our goal is focused on the characterization of antagonists and super-agonists involved in the control of prolactin secretion, using the primary structure of sauvagine as a model for the design of new compounds.
Considering the network among the immune system, the neuroendocrine system, and the olfactory system, these molecules could have a
therapeutic applications on the treatment of neuroimmunology disorders (not excluded the transplant area). References:
Montecucchi, P.C., Henschen, A. and Erspamer, V. : Structure of sauvagine, a vasoactive peptide from the skin of a frog - Hoppe Seyler's Z. Physiol. Chem. 360, 1170 (1979)
Erspamer V, Melchiorri P, Broccardo M, Erspamer GF, Falaschi P, Improota G, Negri L, Renda T.: " The brain-gut-skin triangle: new peptides" - Peptides. 2 Suppl 2: 7-16 (1981)
Falaschi, P., D'Urso, R., Negri, L., Rocco, A., Montecucchi, P.C., Henschen, A., Melchiorri, P. and Erspamer, V. : Potent "in vitro" and "in vivo"
prolactin inhibiting activity of sauvagine, a frog skin peptide - Endocrinology 111, 693 - 695 (1982)
Prolactin: Structure, Function, and Regulation of Secretion by Marc E. Freeman, Béla Kanyicska, Anna Lerant, and György Nagy - Physiological Reviews, 80, 1523-1631 (2000)
The Technology transfer process - Slides
Christmas Greetings and Best Wishes for a Happy New Year
|